Navigation Links
Oak Ridge to lead auto supplier R&D partnership
Date:1/17/2008

he areas on which USAutoPARTs will initially focus are aligned with the Vehicle Technologies Program of DOEs Office of Energy Efficiency and Renewable Energy. Similar support is planned by the U.S. Department of Defense and anticipated from other Federal Agencies as the partnership develops.

Coming on the heels of the President signing new energy legislation last month, this alliance with state government and industry demonstrates a shared commitment to advance highly efficient vehicle technologies that will help reduce our reliance on foreign energy and promote robust economic growth, DOE Under Secretary Albright said. Furthering the Administrations comprehensive effort to increase energy security, we are eager for this alliance to take shape so cleaner, more efficient vehicles can successfully move from the laboratory to the showroom.

Oak Ridge National Laboratory is the leading national laboratory for the Vehicle Technologies Program of DOEs Office of Energy Efficiency and Renewable Energy and is home to the National Transportation Research Center as well as the High Temperature Materials Laboratory and other research facilities where researchers address issues of energy efficiency, air quality and dependence on foreign oil through innovations in engine control strategies, advanced emissions control and measurement, materials, fuels, power electronics, and electric machines.

ORNL is uniquely suited to addressing the needs of American automotive suppliers, said Thom Mason, director of Oak Ridge National Laboratory. We have a broad portfolio of transportation research and expertise in all aspects of the business, from lightweight components made of carbon fiber to electric motors. This partnership will support DOEs mission and help insure Americas future in the automotive business.

USAutoPARTs will be located in Shelby Township, Mich., in a 56,000 square foot vehicle R&D center with established laboratory infrastructure that
'/>"/>

Contact: Larisa Brass
brasslm@ornl.gov
865-574-4163
DOE/Oak Ridge National Laboratory
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Truck-safe bamboo bridge opens in China
2. Story tips from the Department of Energys Oak Ridge National Laboratory, December 2007
3. Story tips from the Department of Energys Oak Ridge National Laboratory, October 2007
4. Story tips from the US Department of Energys Oak Ridge National Laboratory, September 2007
5. New partnership offers outsourced R&D in membrane biology
6. GM, Coskata partnership builds on Oklahoma State University biofuels research
7. MIT, Eni announce energy research partnership
8. United Water, in partnership with Stevens, wins Management Innovation Award
9. Emory, Ohio State launch partnership in predictive and personalized health care
10. Elsevier announces new journal partnership for 2008
11. UD hosts conference on knowledge-based partnerships Nov. 2
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: