Navigation Links
Newly discovered dinosaur likely father of Triceratops
Date:1/31/2011

New Haven, Conn.Triceratops and Torosaurus have long been considered the kings of the horned dinosaurs. But a new discovery traces the giants' family tree further back in time, when a newly discovered species appears to have reigned long before its more well-known descendants, making it the earliest known member of its family.

The new species, called Titanoceratops after the Greek myth of the Titans, rivaled Triceratops in size, with an estimated weight of nearly 15,000 pounds and a massive eight-foot-long skull.

Titanoceratops, which lived in the American southwest during the late Cretaceous period around 74 million years ago, is the earliest known triceratopsin, suggesting the group evolved its large size more than five million years earlier than previously thought, according to Nicholas Longrich, the paleontologist at Yale University who made the discovery. The finding, which will appear in an upcoming issue of the journal Cretaceous Research, helps shed light on the poorly understood origins of these giant horned dinosaurs.

Longrich was searching through scientific papers when he came across a description of a partial skeleton of a dinosaur discovered in New Mexico in 1941. The skeleton went untouched until 1995, when it was finally prepared and identified incorrectly as Pentaceratops, a species common to the area. When the missing part of its frill the signature feature of the horned dinosaurs was reconstructed for display in the Oklahoma Museum of Natural History, it was modeled after Pentaceratops.

"When I looked at the skeleton more closely, I realized it was just too different from the other known Pentaceratops to be a member of the species," Longrich said, adding that the specimen's size indicated that it likely weighed about twice as much as adult Pentaceratops. The new species is very similar to Triceratops, but with a thinner frill,
'/>"/>

Contact: Suzanne Taylor Muzzin
suzanne.taylormuzzin@yale.edu
203-432-8555
Yale University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Newly discovered group of algae live in both fresh water and ocean
2. Georgia Tech team helps decode newly sequenced strawberry genome
3. WHO Fracture Risk Assessment Tool (FRAX) newly released for Singapore
4. Remarkable biological complexity of bacterial cells is focus of newly released book
5. Newly discovered gene enables fish to disappear
6. Chocolate farmers could benefit from newly sequenced cacao genome
7. Body mass index and thrombogenic factors in newly menopausal women
8. Newly identified RNA sequence is key in microRNA processing
9. Newly discovered mechanism controls levels and efficacy of a marijuana-like substance in the brain
10. Rare carnivorous plant on top 10 list of newly discovered species
11. Newly discovered kinase regulates cytoskeleton, and perhaps holds key to how cancer cells spread
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Newly discovered dinosaur likely father of Triceratops
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: