Navigation Links
New York squirrels are nuts about city life
Date:7/22/2014

Curtin University-led research has shown squirrels have adapted to New York City's human behaviour, allowing them to thrive just as well, if not better, than their fellow squirrels in the woods.

Dr Bill Bateman, Senior Lecturer at Curtin's Department of Environment & Agriculture, led the study that proved eastern grey squirrels were able to modify their behaviour in urban environments and prevent unnecessary responses when humans acted in a predictable manner, such as staying on the footpath.

"As we rapidly increase the spread of urbanisation around the world, urban areas may end up being important places for some wildlife, so it would be good to know what they like about those areas, what allows them to do well and whether humans want them to be there," Dr Bateman said.

"If we do want them there, we need to know how we can help their continued success, and perhaps encourage other animals to share our urban spaces.

"After watching the clear-cut behaviour of squirrels many times in New York, I decided to take these observations further and determine to what extent squirrels modify their behaviour when approached by humans."

Together with Murdoch University's Associate Professor Trish Fleming the research team measured alert distance, flight initiation distance, and distance fled to see if they could discriminate between pedestrians who look directly at them and those that did not, as well as how they reacted when pedestrians left the footpath.

According to the research, only five per cent of squirrels showed signs of being alerted if the human remained on the footpath and did not look at them, while 90 per cent of squirrels moved away, with longer flight distance, when approached by a pedestrian that moved off the footpaths and looked at them.

"This research shows squirrels are able to modulate their behaviour when humans behave in a predictable manner, reducing unnecessary responses and impro
'/>"/>

Contact: Megan Meates
megan.meates@curtin.edu.au
61-892-664-241
Curtin University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Robosquirrels versus rattlesnakes
2. Red Squirrels showing resistance to squirrelpox
3. Study reveals new ways deadly squirrelpox is transmitted to red squirrels
4. Protecting mainland Europe from an invasion of grey squirrels
5. Teaching about hearing can save young peoples ears
6. A birds song may teach us about human speech disorders
7. Fielding questions about climate change
8. New research about facial recognition turns common wisdom on its head
9. New discoveries about brain-hand connection sought to improve therapies, treatments, prosthetics
10. Expedition to undersea mountain yields new information about sub-seafloor structure
11. Consumers need simple, concise messages about benefits of phytonutrients
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
New York squirrels are nuts about city life
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... the immune system, a line of genetically engineered mice can ... of Medicine in St. Louis have found. , Scientists ... system component, a group of molecules known as the Major ... that is similar enough to step in and fill the ...
... to exist and even thrive in surroundings ranging from ... from the Weizmann Institute's Plant Sciences Department, led by ... just two amino acids (the building blocks of protein) ... temperatures and being adapted to living in extreme heat. ...
... has found that large segments of the Pacific Ocean ... the absence of the mineral stresses these microscopic ocean ... ocean productivity appear more robust than it really is. ... data may be inaccurate, the researchers say, and the ...
Cached Biology News:Mice lacking key immune component still control chronic viral infections 2Mice lacking key immune component still control chronic viral infections 3Bacteria beat the heat 2Iron critical to ocean productivity, carbon uptake 2Iron critical to ocean productivity, carbon uptake 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Workshop Set for Sept. 3, UPPSALA, Sweden and ... Bernard de Bruyne, M.D., Ph.D., will present the,benefits of ... the outcomes of multivessel PCI in a workshop at ... The EBAC-accredited,workshop, which is sponsored by Radi Medical Systems, ...
... Cepheid (Nasdaq:,CPHD) will present at the Thomas Weisel ... Hotel, Boston, September 5 to 7, 2007. Chief,Executive ... Finance and,Chief Financial Officer, John R. Sluis will ... The webcast, along with accompanying presentation slides, may ...
... Verenium,Corporation (Nasdaq: VRNM ), a leading developer of ... high-performance specialty,enzymes, announced today that Carlos A. Riva, President ... the Cowen and Company Clean,Energy Conference. The presentation is ... 6, 2007 and will take place at Le Parker ...
Cached Biology Technology:Interventional Cardiologists Nico Pijls, Bernard De Bruyne to Discuss Benefits of Measuring Coronary Pressure in Improving Multivessel PCI at ESC Congress 2007 2Cepheid to Present at Thomas Weisel Partners Healthcare Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: