Navigation Links
NJIT receives second part of $1M gift to chemical engineering department
Date:7/7/2011

NJIT announced today the fulfillment of the late Otto H. York's $1M pledge to NJIT. Daughter of the visionary York, Myrth York of Providence, RI, presented NJIT with a check for $490,000 to complete the commitment to the Otto H. York Department of Chemical, Biological and Pharmaceutical Engineering. In 2002, the department was named in honor Otto H. York, chemical engineer, entrepreneur, philanthropist, and long-time benefactor of the university. York had pledged $1M to the department to establish an endowment supporting scholarships to attract outstanding students and to support faculty research.

"Over the years, NJIT has had many reasons to be grateful for the deep personal concern that Otto York showed for our university, and for his generous financial support," said NJIT President Robert A. Altenkirch. "But his concern and support are not just part of our past; they are very much invaluable components of our future. Otto York's legacy of engagement with the department of chemical, biological and pharmaceutical engineering that bears his name will enable NJIT to foster the talents of exceptional young women and men, and to maintain our leadership in disciplines vital to the prosperity of New Jersey and the nation."

The gift empowers Chairman Norman Loney, PhD, to actuate his five-year plan.

Following the Engineer of 2020 vision of the National Academy of Engineering (NEA), http://www.nae.edu/programs/education/activities10374/engineerof2020.aspx Loney's strategy connects diversity and industry. As his first initiative, Loney will bring on board a female university lecturer with professional pharmaceutical industry research experience who will help to pursue opportunities for NSF-funded student experiential education. The new faculty member will continue to connect with industry to build a long-range plan including increased hands-on exp
'/>"/>

Contact: Sheryl Weinstein
sheryl.m.weinstein@njit.edu
973-596-3436
New Jersey Institute of Technology
Source:Eurekalert

Page: 1 2

Related biology news :

1. Geneticist receives Excellence in Science Award from coalition of biomedical researchers
2. University of Texas at Austin professor receives Donald L. Katz Award
3. CSHL professor Rob Martienssen receives prestigious appointment as HHMI-GBMF investigator
4. Wildlife Conservation Society receives $150,000 grant from Newmans Own Foundation to save gorillas
5. Rensselaer scholar receives NSF Research Fellowship
6. Dr. Knut Stamnes at Stevens receives NASA grant for environmental monitoring
7. NTU receives $250,000 gift to promote groundbreaking research in sustainability
8. JGIs Susannah Tringe receives prestigious $2.5M DOE Early Career Research Award
9. Harvards engineering school receives $100,000 Grand Challenges Explorations grant
10. Yuemeng Dai, M.D., Ph.D., ear, nose and throat specialist, receives Bill Potsic Basic Science Award
11. Stephen Maturo, M.D., ear, nose and throat specialist, receives Charles Ferguson Award
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: