Navigation Links
Misplaced molecules: New insights into the causes of dementia
Date:3/1/2013

sease."

Studies on zebrafish

However, until now little was known about the function of TDP-43. What are the consequences when this protein becomes non-functional? In order to answer this question, the team led by Bettina Schmid cooperated with the research group of Prof. Christian Haass to investigate the larvae of specially bred zebrafish. Their genetic code had been modified in such a way that no TDP-43 was produced in the organism of the fish. The result: the young fish showed massive muscle wasting and died a few days after hatching. Moreover, the extensions of the nerve cells which control the muscles were abnormal.

"To some extent, these are symptoms typical of ALS and FTD. Therefore, a loss of function of TDP-43 does seem to play a critical role in the disease," says Haass, Site Speaker of the DZNE Munich Site and chair of Metabolic Biochemistry at LMU.

The study revealed one more finding which surprised the researchers: the blood flow of the fish was massively disturbed. "It is well known that circulatory disorders play a part in other forms of dementia, notably in the case of Alzheimer's," says Haass. "We now want to investigate whether such problems with blood flow may be a general problem of neurodegenerative diseases and whether such problems occur particularly in patients with ALS and FTD."


'/>"/>

Contact: Dirk Frger
presse@dzne.de
0049-228-433-02260
Helmholtz Association of German Research Centres
Source:Eurekalert

Page: 1 2

Related biology news :

1. Study provides insights into plant evolution
2. Life experiences put their stamp on the next generation: New insights from epigenetics
3. Discovery of sexual mating in Candida albicans could provide insights into infections
4. New insights into the borderline personality brain
5. Study offers new insights into the mechanics of muscle fatigue
6. New insights into how immune system fights atherosclerosis
7. Study offers insights into role of muscle weakness in Down syndrome
8. Basketball teams offer insights into building strategic networks
9. Research provides new insights into dogs natural feeding behavior and finds they target a daily dietary intake that is high in fat
10. Insights into a new therapy for a rare form of cystic fibrosis
11. Notre Dame research could provide new insights into tuberculosis and other diseases
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Fibrocell Science, Inc. (OTC Bulletin Board: FCSC) announced today ... U.S. Food and Drug Administration (FDA) related to the Biologics ... the treatment of moderate to severe nasolabial fold wrinkles in ... Center for Biologics Evaluation and Research (CBER) when the review ...
... , ANNAPOLIS, Md., Dec. 21 PharmAthene, Inc. (NYSE Amex: ... biological and chemical threats, today announced the appointment of Jeffrey ... Board to eight members. , Dr. Runge is a ... in business risk management, homeland security and homeland defense. ...
... , BOTHELL, WA and VANCOUVER, ... OGXI ) announced today that the Company will host a ... 21, 2009. , A live webcast will be available through ... http://ir.oncogenex.com . Alternatively, you may access the live conference ...
Cached Biology Technology:Fibrocell Science, Inc. Receives FDA Complete Response Letter Regarding azficel-T for Wrinkles 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 3OncoGenex Pharmaceuticals to Host Investor Conference Call at 8:30 a.m. ET, December 21, 2009 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: