Navigation Links
Mercury contamination in water can be detected with a mobile phone
Date:2/6/2013

Chemists at the University of Burgos (Spain) have manufactured a sheet that changes colour in the presence of water contaminated with mercury. The results can be seen with the naked eye but when photographing the membrane with a mobile phone the concentration of this extremely toxic metal can be quantified.

Mercury contamination is a problem that is particularly affecting developing countries. It poses a risk to public health since it accumulates in the brain and the kidneys causing long term neurological illnesses. It is emitted from industrial and mining waste, especially small-scale gold mining.

A team at the University of Burgos have now developed a technique for detecting the presence of this dangerous metal in water "in a cheap, quick and in situ way," as explained to SINC by Jos Miguel Garca, one of the authors of the study. Details have been published in the 'Analytical Methods' journal.

The method consists of placing the fine sheet created by the researchers in the water for five minutes. If it turns red, this signals the presence of mercury. "Changes can be seen by the naked eye and anyone, even if they have no previous knowledge, can find out whether a water source is contaminated with mercury above determined limits," outlines the lecturer Garca.

In addition, if we take a photograph of the sheet with a digital camera, like those in mobile phones or tablet computers, we can find out the concentration of the metal. We only need image treatment software (the team used the open access GIMP programme) to see the colour coordinates. The result is then compared with reference values.

The membrane contains a florescent organic compound called rhodamine, which acts as a mercury sensor. "Rhodamine is insoluble in water," says the researcher. "But we chemically fix it to a hydrophilic polymer structure in such a way that when put into water it swells and the sensory molecules are forced to remain in the
'/>"/>

Contact: Press Office
info@agenciasinc.es
34-914-251-820
FECYT - Spanish Foundation for Science and Technology
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Mercury in dolphins: Study compares toxin levels in captive and wild sea mammals
2. NIST launches new website to educate industry about alternatives to mercury thermometers
3. Mercury rising: Greater L.A. to heat up an average 4 to 5 degrees by mid-century
4. Mercury mineral evolution
5. Measuring mercury levels: Nano-velcro detects water-borne toxic metals
6. Mercury in water, fish detected with nanotechnology
7. Mercury releases contaminate ocean fish: Dartmouth-led effort publishes major findings
8. GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury
9. Researchers develop rapid test strips for bacterial contamination in swimming water
10. New study confirms erroneous link between XMRV and prostate cancer-contamination was the cause
11. Ozone treated water v. lethal microbial material
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Mercury contamination in water can be detected with a mobile phone
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: