Navigation Links
Media invited: Biophysical Society Annual Meeting
Date:1/18/2013

group of chemicals associated with autism to find the mutations most likely responsible for the disease.

Presentation #118-Plat: "Functional evaluation of autism associated mutations in SLC9A9 (NHE9)" http://tinyurl.com/apjmm7a

The Modus Operandi of a Parasite: Encephalitis and other neurologic diseases are the potential consequences of an infection with T. gondii, a cousin of the parasite that causes malaria. Researchers explore how this protozoan infects its host on a cellular level.

Presentation #716-Pos: "Toxoplasma gondii targets the host actin cytoskeleton during invasion, go figure" http://tinyurl.com/am4ddxl

MONDAY, FEBRUARY 4

Seeing Cell Temperature: The temperature of a cell's inner parts can reveal much about its health. A new virtual thermometer that shows how temperature is distributed within a living cell may yield new insights into cell function.

Presentation #1033-Plat: "Imaging of temperature distribution in a living cell" http://tinyurl.com/b6dnae6

The Nanomechanical Signature of Breast Cancer: When healthy breast tissue transforms into cancerous tissue, its mechanical properties also change. Examining cells' stiffness profiles may reveal a new signature of breast cancer.

Presentation # 1639-Pos: "The nanomechanical signature of breast cancer" http://tinyurl.com/b2edbq6

Listening to Cells: Cells could have a lot to tell us, if we could only listen. A new noninvasive technique allows researchers to probe the insides of cells with sound.

Presentation # 991-Plat: "Listening to cells: A non-contact optoacoustic nanoprobe" http://tinyurl.com/a3a8oxs

TUESDAY, FEBRUARY 5

<
'/>"/>

Contact: Ellen Weiss
eweiss@biophysics.org
240-290-5606
American Institute of Physics
Source:Eurekalert

0

GOOD

Page: 1 2 3 4 5

Related biology news :

1. New report finds increase in media coverage of synthetic biology
2. BodyMedia & FitOrbit Up the Ante in Personalized Weight Loss
3. Medbox, Inc. Featured in Multiple Media Stories in Massachusetts and California
4. Outside a vacuum: Model predicts movement of charged particles in complex media
5. Medbox, Inc. Releases Demo Video and Collateral Media Concerning How Their Systems Will Be Used in Massachusetts Medical Marijuana Dispensaries
6. Evermedia Group Announces 375% Increase in Revenue for Second Quarter 2012
7. Media registration opens for Neuroscience 2012, worlds largest brain science meeting
8. NineSigma Launches NineSights, the Worlds First Open Innovation Social Media Destination for Innovation Seekers and Solution Providers
9. G protein-coupled receptor mediates the action of castor oil
10. Biophysical Society announces 2013 New and Notable Symposium speakers
11. Biophysical Society announces winners of 2013 international travel awards
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: