Navigation Links
Lab test for allergy scoops national
Date:11/26/2008

ing the symptoms of allergy. Cellular activation can then be analysed to discover which of the allergens are prompting the release of histamine and other chemicals indicative of allergic reaction in the patient's blood.

Dr Marcos Alcocer, a lecturer in the School of Biosciences, said: "The whole idea is to trace what we call our immunological profile, the finger print of our immune system which tells us how we react to the things which we are surrounded by.

"Our technology is one step towards the ultimate goal of being able to have a full in-vitro diagnostic test for allergy. What we have to do now is examine the results of our test further and then assess how well it works compared to the gold standard techniques currently used for diagnosis. We will then be in a very good position for commercialisation."

Researchers from The University of Nottingham were also highly commended in the Clinical Impact category of the Da Vinci Awards. A collaboration between Professor Ian Ellis in the University's School of Molecular Medical Sciences and colleagues at Nottingham Trent University and University Hospital Nottingham has led to the development of a breast cancer prognostic tool.

Nottingham Prognostic Index offers a personalised approach to medicine by classifying patients into groups according to their tumour biology, provides information about the patients' most probable survival outcome and guides clinicians in the most appropriate form of treatment.

The tool should reduce the incidence of over-treatment and minimise the harmful side-effects for patients and is due to be commercialised by a spin-out company Nottingham Prognostics.

Anna Seddon, Manager of the Da Vinci Network, said: "The excellent response to the Da Vinci Awards reinforces the importance of building interdisciplinary and inter-institutional collaboration to address critical issues in healthcare. The quality of applicants reflects the wealth of activi
'/>"/>

Contact: Emma Thorne
emma.thorne@nottingham.acuk
44-011-595-15793
University of Nottingham
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Expert recommends town councils to design low-allergy impact green spaces
2. Munich researchers discover key allergy gene
3. NIAID announces grants to stimulate food allergy research
4. NIH selects LIAI for major study on allergy molecular causes and possible treatments
5. RSC Project Prospect scoops prestigious award
6. Halas wins high-profile national security award
7. New national survey says public reveres bison
8. National and international doctoral training
9. International team discovers gene associated with epilepsy
10. PNNL leadership in carbon sequestration featured at international conference
11. Engineer to present leak-proof method for carbon dioxide storage at international conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: