Navigation Links
ISU researchers help map first plant-parasitic nematode genome sequence
Date:9/4/2008

AMES, Iowa -- There are numerous plant-parasitic nematodes in the world, but only a handful are responsible for the largest part of an estimated $157 billion in agricultural damage globally every year. Nematodes are small worms that burrow into plant roots and feed off living cells.

Now, Iowa State University researchers have contributed to the release of the annotated genome of one of the most destructive nematodes: Meloidogyne incognita -- the southern root-knot nematode, as reported recently in the journal Nature Biotechnology.

Sequencing the genome is a critical step toward comprehensively understanding how the organism works and may pave the way for research on ways to fight the pest.

"This is considered to be one of, if not the most important plant-parasitic nematode species across the world," said Thomas Baum, professor and chair of plant pathology and head of Iowa State University's contribution to the genome sequence project.

Root-knot nematodes are so important because they can be found almost anywhere in the world on almost any plant, he said. Nematodes are the most abundant animals on earth.

"Many of the nematodes that are really bad pathogens are very specialized on which plant they attack," said Baum. "This nematode has a huge host range. For us nematologists, it is very interesting and challenging to study."

Because the pest is so widespread, many nematologists around the world were eager to help with the project. The lead investigator was Pierre Abad of the Insitut National de Recherche Agronomiquea, a French research group, with help from researchers in Belgium, Holland, Great Britain, Switzerland, and Iowa State University and North Carolina State University in the US.

"Because it is such a worldwide problem, people are eager to contribute," Baum said. "Also, because it is the first plant-parasitic nematode to have its sequence released, people are very excited abou
'/>"/>

Contact: Thomas Baum
tbaum@iastate.edu
515-294-2398
Iowa State University
Source:Eurekalert

Page: 1 2

Related biology news :

1. Researchers identify proteins involved in new neurodegenerative syndrome
2. Texas researchers and educators head for Antarctica
3. MGH researchers describe new way to identify, evolve novel enzymes
4. University of Pennsylvania researchers develop formula to gauge risk of disease clusters
5. U of MN researchers discover noninvasive diagnostic tool for brain diseases
6. U of Minnesota researchers discover noninvasive diagnostic tool for brain diseases
7. Researchers discover new strategies for antibiotic resistance
8. Researchers find new taste in fruit flies: carbonated water
9. Binghamton University researchers investigate evolving malaria resistance
10. UIC researchers find promising new targets for antibiotics
11. Researchers develop simple method to create natural drug products
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... Dec. 18, 2014 Egenix, Inc. is pleased to ... Chairman of the Board, to succeed Donald Fresne ; ... will continue as a member of the Board.  In recognition ... to the company over almost twenty years, the Board designated ... of Directors has established a Search Committee to find a ...
(Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
(Date:12/17/2014)... 17, 2014 Achim Noack has been ... Stoller Group. In this position, Noack will assist Jerry ... matters, develop marketing strategy and supervise global marketing management ... “Achim has tremendous knowledge and experience in the crop ... “His experience and innovative thinking will be a great ...
(Date:12/17/2014)... Dallas, Texas (PRWEB) December 17, 2014 ... research on Global Quartz Tubing industry. For an ... information, definition, classification, application, industry chain structure, industry ... domestic quartz tubing industry has witnessed ... through a number of acquisitions. This report mentions ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 22020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: