Navigation Links
Global Fingerprint Biometrics Industry
Date:3/21/2013

an Federal
Election Institute II-55
Oberthur Technologies Enters into Technology Partnership with
Zvetco Biometrics II-56
Apple to Take Over AuthenTec II-56
M2SYS Technology and Integrated Systems Enter Into Partnership II-56
Key Source International Collaborates with Lumidigm II-56
Asia Commercial Bank Selects FS88 Fingerprint Scanner for
Fingerprint Authentication System II-57
Morpho Deploys MorphoBIS through MorphoTrak II-57
Morpho Deploys MorphoBIS Fingerprint Identification System for
Swedish National Police Board II-58
Digicel Pacific Deploys Biometric Identification System for
Money Transfers II-58
ASMAB Selects Hybrid Biometric PlatformTM Technology of HPC
Informatique II-58
Colorado Bureau of Investigation Selects MorphoTrak for
MorphoBIS II-58
Cross Match Technologies Deploys Hand-Held Fingerprint
Scanners at Police and Sheriff's Departments II-59
3M Cogent Secures Contract for Supplying High-resolution
LiveScan Booking Systems and Biometric Identification
Solutions to HKPF II-59
Safran Acquires L-1 Identity Solutions II-60
Argus Global Enters Into Partnership with iEvo II-60
Warwick Warp and WCC Enter Into Partnership II-60
NEC Deploys Automated Fingerprint Identification System in
Anhui Province of China II-60
Asia Commercial Bank Introduces Fingerprint Identification
System II-61
Warwick Warp Opens New Office in TianJin of China II-61
Interforce International to Introduce Fingerprint
Identification Scanning Technology II-61
FBI Selects Next Generation Identification System (NGIS) of
Lockheed Martin II-62
Morpho Offers Biometric Device to STJ Electronics II-62
South Korean Ministry of Justice Selects Cross Match
Technologies and Digent for Foreigners' Fingerprint
Verification System II-62
Morpho Deploys MorphoBIS at Edmonton
'/>"/>
SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19

Related biology news :

1. Novo Nordisk and BGI establish global collaboration framework
2. EU-funded study underlines importance of Congo Basin for global climate and biodiversity
3. Global warming threat to coral reefs: Can some species adapt?
4. 1 solution to global overfishing found
5. Young researcher taking fight against global killer to the next level in Vietnam
6. Heightened Security Threats and Economic Issues Provide Fillip to Global Civil and Military Biometrics Market, Says Frost & Sullivan
7. Global Information Inc. Announces Discounted Conference Registration For Bio-IT World Asia and Biodetection Technologies 2012
8. Global effort launched to save turtles from extinction
9. New Biotech and Pharmaceutical Market Research from Global Information Inc Forecasts Strong Growth Coming Out of Recession
10. 2012 Forecast for US Molecular Diagnostics Market Now Available From Global Information Inc.
11. Desert to Rainforest global classroom links future teachers, classrooms in Phoenix and Panama
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: