Navigation Links
German National Academy of Sciences issues a critical statement on the use of bioenergy
Date:7/26/2012

In a statement on the chances and limits of using bioenergy, the German National Academy of Sciences Leopoldina has come to the conclusion that in quantitative terms, bioenergy plays a minor role in the transition to renewable, sustainable energy sources in Germany at the present time and probably in the future. Bioenergy requires more surface area, is associated with higher greenhouse gas emissions and is more harmful to the environment than other renewable sources such as photovoltaic, solar thermal energy and wind energy. In addition, energy crops potentially compete with food crops. The report recommends finding strategies for saving energy and increasing energy efficiency.

The Leopoldina's statement "Bioenergy Chances and Limits" was compiled by a working group of more than 20 expert scientists established in 2010. The report provides recommendations for using bioenergy, defined as energy obtained from burning of non-fossil plant biomass or biofuels derived primarily from biomass.

The statement also outlines under which conditions the utilization of bioenergy is appropriate and what kind of technologies are currently available or are being developed to convert biomass into biofuels such as bioethanol and biodiesel. In addition, it introduces various scientific approaches aimed at producing hydrogen from water in a sustainable and environmentally friendly manner.


'/>"/>
Contact: Caroline Wichmann
presse@leopoldina.org
0049-345-472-39800
Leopoldina
Source:Eurekalert

Page: 1

Related biology news :

1. Copernicus Award 2012 for German-Polish collaboration in business information systems
2. Story tips From the Department of Energys Oak Ridge National Laboratory, March 2012
3. Ultracold matter technology from CU and SRI International licensed to Boulders ColdQuanta
4. International Polar Year conference: From knowledge to action
5. ASBMB wins National Science Foundation grant to enhance K-12 science education
6. President, CEO Leppävuori, VTT: Finland should create a national bioeconomy strategy
7. Russia declares Land of the Leopard National Park
8. Large international study finds memory in adults impacted by versions of 4 genes
9. International team uncovers new genes that shape brain size, intelligence
10. As deadly cat disease spreads nationally, MU veterinarian finds effective treatment
11. Southampton researchers lead 2 international projects to help people out of poverty
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/2/2014)... World , James Dacey explores the ways in which ... their innovations from the lab into the commercial market. ... start-up companies as they move from prototype to product ... factors: physics-based inventions are usually far from market-ready when ... a lot more complicated than had been originally thought. ...
(Date:11/2/2014)... Feynman walk into a bar and bump into a biologist ... setup to some late-night nerd sketch, researchers have taken this ... modern biology, namely, finding meaning in the rising oceans of ... of cancer mutations that genome-wide studies are publishing at a ... to parse the signal from the noise (and there is ...
(Date:10/31/2014)... still live in Nuristan Province – some 60 years ... scent glands are more valuable than gold , Study ... Oryx , NEW YORK (October 31, 2014) – ... a strange deer with vampire-like fangs still persists in ... a research team led by the Wildlife Conservation Society ...
Breaking Biology News(10 mins):The 'valley of death' facing physics start-ups 2Mutant models 2Mutant models 3Mutant models 4Strange, fanged deer persists in Afghanistan 2
... microbiologist James Holden of the University of Massachusetts Amherst launches ... the cracks and thermal vents around an undersea volcano, for ... will not be funded by a government source. ... oceanographic research: The Gordon and Betty Moore Foundation started by ...
... YORK , Aug. 16, 2013   EyeLock Inc. , a market ... Roger An as Vice President of Global Market ... research, analysis and strategic initiatives to further the embedded applications ... heavy focus on Asia .   ...
... CITY)If terrorists targeted the United States with an anthrax attack, ... such as knowing the likelihood of an individual becoming ... and how long to give antibiotics to protect people ... anthrax-laced letters killed five people and infected 17 others in ...
Cached Biology News:Google, Intel founders support undersea research by UMass Amherst microbiologist 2Google, Intel founders support undersea research by UMass Amherst microbiologist 3EyeLock Appoints Roger An Vice President of Global Market Development 2EyeLock Appoints Roger An Vice President of Global Market Development 3Answering crucial questions about anthrax exposure 2Answering crucial questions about anthrax exposure 3Answering crucial questions about anthrax exposure 4
(Date:11/15/2014)... November 14, 2014 The "Operating ... Surgical, Performance), by Application (Perioperative, Preoperative, operating room ... (Web-Based, On-Premise) - Global Forecast to 2019.” defines ... an analysis and forecast of value by product, ... Along with this, the value and volumes of ...
(Date:11/15/2014)... (PRWEB) November 14, 2014 New photonics ... SPIE Startup Challenge 2015 , an opportunity to pitch ... development experts and venture capitalists. The annual competition is ... Moscone Center in San Francisco, running 7-12 February and ... and photonics . , Cash prizes, including $10,000 for ...
(Date:11/15/2014)... Algenol Biofuels will present at CleanEquity Monaco 2015 ... Monaco . Logo - ... invitation-only event hosted by Innovator Capital, the London ... and sponsors include Prince Albert II of ... PR Newswire, the Monte-Carlo SBM, Oceanographic Museum of ...
(Date:11/15/2014)... Anthera Pharmaceuticals, Inc. (NASDAQ: ANTH ), today ... quarter ended September 30, 2014. Net ... was $7.0 million, compared to $5.8 million for the ... is mainly driven by higher research and development expense ... our Phase 3 systemic lupus erythematosus clinical study, CHABLIS-SC1, ...
Breaking Biology Technology:Operating Room Management Market Worth $4,551.1 Million by 2019 - New Report by MarketsandMarkets 2Operating Room Management Market Worth $4,551.1 Million by 2019 - New Report by MarketsandMarkets 3Operating Room Management Market Worth $4,551.1 Million by 2019 - New Report by MarketsandMarkets 4New Photonics Entrepreneurs Need to Apply Now for SPIE Startup Challenge 2015 2New Photonics Entrepreneurs Need to Apply Now for SPIE Startup Challenge 2015 3Algenol Biofuels Selected to Present at CleanEquity Monaco 2015 2Anthera Pharmaceuticals Reports 2014 Third Quarter Financial Results and Operational Update 2Anthera Pharmaceuticals Reports 2014 Third Quarter Financial Results and Operational Update 3Anthera Pharmaceuticals Reports 2014 Third Quarter Financial Results and Operational Update 4Anthera Pharmaceuticals Reports 2014 Third Quarter Financial Results and Operational Update 5Anthera Pharmaceuticals Reports 2014 Third Quarter Financial Results and Operational Update 6
... president of Niceware International , a Milwaukee developer ... Matter has seen identification software used to track parts ... only a matter of time before healthcare facilities came ... founded in 2002, has produced NiceLabel software for the ...
... - In a criminal trial, as any fan of TV ... defense goes second. The accused can appear in deep trouble, at ... often carries the day. , ,Not only does that make for ... works in real life. Those who file the charges speak first, ...
... Milwaukee, Wis . - Midwest Fiber Networks , which ... by March of 2008, has been granted a reprieve by ... the project. , ,The council has voted to give Midwest ... or demonstration area, of the citywide wireless network. The company ...
Cached Biology Technology:Software company enters health space with RFID solutions on hold 2Software company enters health space with RFID solutions on hold 3Here's why Wisconsin's stem cell patents are being challenged 2Here's why Wisconsin's stem cell patents are being challenged 3Here's why Wisconsin's stem cell patents are being challenged 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products: