Navigation Links
Genetic defect found to cause severe epilepsy and mental retardation
Date:10/12/2010

BEER-SHEVA, Israel, October 12, 2010 A research team at Ben-Gurion University of the Negev and Soroka University Medical Center in Beer-Sheva, Israel has detected a genetic mutation resulting in a progressive disease of severe mental retardation and epilepsy beginning at infancy. The research was just published in the American Journal of Human Genetics.

The team, led by BGU Prof. Ohad Birk of the National Institute for Biotechnology in the Negev determined that the defect is associated with the production of the 21st amino acid, selenocysteine (SEC), which leads to progressive brain atrophy.

According to Prof. Birk, "One out of every 40 Jews of both Moroccan and Iraqi ancestry may be carriers of this mutation. As the disease is both severe and common, testing for these mutations is expected to become a routine prenatal genetic screening test in these two populations, enabling prevention of future cases."

It is believed that further research will identify other mutations in the same gene as the cause of mental retardation with epilepsy in other communities. As the disease is progressive, elucidation of its molecular mechanisms might open new venues to treatment, preventing disease progression.

The human genetic code, as deciphered some 50 years ago, encodes 20 amino acids which are the building blocks of all proteins in the human body. However, in recent years it became apparent that a 21st amino acid exists: selenium, entering the body in food, is incorporated in the human tissues into what is known as selenocysteine.

This 21st amino acid is unique in that it is encoded by what is normally a stop codon that is, a DNA sequence that normally instructs the protein building system to end the chain of amino acids, terminating the generated protein. In contrast with most genes, some 25 genes have a unique component that manipulates the stop codon so that instead of terminating the evolving protein chain, it
'/>"/>

Contact: Andrew Lavin
andrewlavin@alavin.com
516-944-4486
American Associates, Ben-Gurion University of the Negev
Source:Eurekalert

Page: 1 2

Related biology news :

1. FDA funds pediatric trial testing genetically reprogrammed HSV to treat cancer
2. Studies provide new insights into the genetics of obesity and fat distribution
3. Study reveals cancer-linked epigenetic effects of smoking
4. Twins provide clue that genetic epilepsy can originate in the embryo
5. Researchers find first genetic evidence for loss of teeth in the common ancestor of baleen whales
6. Notre Dame and Wyoming scientists genetically engineer silkworms to produce artificial spider silk
7. Insecticides from genetically modified corn present in adjacent streams
8. Light workout: Stanford scientists use optogenetics to effectively stimulate muscle movement in mice
9. Genetic ancestry: A new look at racial disparities in head and neck cancer
10. Genetic clues to evolution of jaws in vertebrates unearthed by CU-led team
11. Hard-wired for chocolate and hybrid cars? How genetics affect consumer choice
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: