Navigation Links
Enhanced NIST instrument enables high-speed chemical imaging of tissues
Date:7/22/2014

marginal quality spectrum with other coherent Raman spectroscopies, or even seconds for a spectrum from more conventional spontaneous Raman instruments. Because it's capable of registering many more spectral peaks in the fingerprint region, each pixel carries a wealth of data about the biomolecules present. This translates to high-resolution imaging within a minute or so whereas, notes NIST electrical engineer Charles Camp, Jr., "It's not uncommon to take 36 hours to get a low-resolution image in spontaneous Raman spectroscopy."

"There are a number of firsts in this paper for Raman spectroscopy," Camp adds. "Among other things we show detailed images of collagen and elastinnot normally identified with coherent Raman techniquesand multiple peaks attributed to different bonds and states of nucleotides that show the presence of DNA or RNA."


'/>"/>

Contact: Michael Baum
michael.baum@nist.gov
301-975-2763
National Institute of Standards and Technology (NIST)
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Enhanced royal jelly produces jumbo queen bee larvae
2. Potential drug molecule shows enhanced anti-HIV activity
3. Discovery may pave way to genetically enhanced biofuel crops
4. Musicians who learn a new melody demonstrate enhanced skill after a nights sleep
5. Xyngular Announces the Launch of its New Xyng Enhanced Formula
6. Better broccoli, enhanced anti-cancer benefits with longer shelf life
7. 660 nm red light-enhanced BMSCs transplantation for hypoxic-ischemic brain damage
8. WHOI scientists/engineers partner with companies to market revolutionary new instruments
9. UNH labs receive 2 NSF grants totalling $1.35m for research instruments
10. Exclusive agreement to distribute Affinity Biosensors Archimedes system extends Malvern Instruments biopharma solutions
11. BiOptix to highlight new 404pi instrument at European symposia
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Enhanced NIST instrument enables high-speed chemical imaging of tissues
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
(Date:9/19/2014)... DIEGO , Sept. 19, 2014 Pfenex ... in the development of high-value and difficult to manufacture ... be presenting at the 21 st Annual NewsMakers ... York . Bertrand Liang , chief executive ... company,s development programs and business strategy on Friday, September ...
(Date:9/19/2014)... , September 19, 2014 ... 53rd European Society for Paediatric Endocrinology (ESPE) Meeting  ... science and medical research in the field of growth  ... KGaA, Darmstadt, Germany , today announced ... (GGI) for 2014. The awards were announced during a ...
(Date:9/18/2014)... , Sept. 18, 2014 /PRNewswire-iReach/ -- DeepResearchReports.com adds ... Acetic Acid Industry" and "2014 Deep Research Report ... to its research database. Photo - ... Research Report on Global and China Acetic Acid ... on China and Global ...
(Date:9/18/2014)... (PRWEB) September 18, 2014 On Tuesday, ... and Sen. Jim Risch for National Lab Day on ... from across the national laboratory system. Durbin and Risch ... aims to increase awareness of the reach of the ... and discoveries to address some of our nation's most ...
Breaking Biology Technology:Pfenex to Present at Upcoming Industry Conference on September 26 2EMD Serono Awards Grant for Growth Innovation (GGI) for the First Time 2EMD Serono Awards Grant for Growth Innovation (GGI) for the First Time 3Acetic Acid Market & Sodium Stannate Industry (China, Global) Research Report 2Acetic Acid Market & Sodium Stannate Industry (China, Global) Research Report 3Acetic Acid Market & Sodium Stannate Industry (China, Global) Research Report 4Lab Day Highlight Labs' Contribution to U.S. Competitiveness and Innovation 2Lab Day Highlight Labs' Contribution to U.S. Competitiveness and Innovation 3
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: