Navigation Links
Embryonic stem cell strategy advanced with UCSF finding
Date:9/11/2007

UCSF scientists are reporting what they say is a significant improvement in the technique for genetically reprogramming mouse cells to their embryonic state, a process that transforms the cells, in essence, into embryonic stem cells.

The finding, published on-line as an immediate early publication in Cell Stem Cell (Sept. 6, 2007), builds on the strategic breakthrough reported by Shinya Yamanaka, MD, PhD, in 2006, and confirmed in the spring of 2007 both by Yamanakas team and, in independent studies, by scientists at MIT, Harvard and UCLA.

The advance by the UCSF team should accelerate research aimed at improving the original strategy, the team says, and increase its potential use for studying disease development and creating patient-specific stem-cell based therapies.

The work is the result of a collaboration between the labs of Miguel Ramalho-Santos, PhD, and Robert Blelloch, MD, PhD, of the UCSF Institute for Regeneration Medicine.

The new technique removes a major technical hurdle that has likely discouraged many labs around the world from carrying out studies on the strategy, says senior author Ramalho-Santos, a UCSF Fellow and a member of the Diabetes Center. For separate reasons, he says, removal of the hurdle increases the techniques potential use in developing patient-specific cellular therapies.

Now, laboratories will be able to use the approach to study a broad range of normal and diseased cells of interest, says the first author of the study, Blelloch, an assistant professor of urology. There will be a much greater ability to precisely dissect the mechanisms of reprogramming and to identify the genes that will be most effective in transforming adult cells.

Yamanakas strategy -- over-expressing certain genes in mouse skin cells to initiate reprogramming relied on the insertion of a foreign drug resistance gene into the mouse skin cells. This gene would switch on in those cells that successfully
'/>"/>

Contact: Jennifer O'Brien
jobrien@pubaff.ucsf.edu
415-476-2557
University of California - San Francisco
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. Priming embryonic stem cells to fulfill their promise
2. Current human embryonic stem cell lines contaminated UCSD/Salk team finds
3. Transplantation Of Monkey Embryonic Stem Cells Reverses Parkinson Disease In Primates
4. UCSD Discovery Shows How Embryonic Stem Cells Perform Quality Control Inspections
5. Researchers devise way to mass-produce embryonic stem cells
6. Protein helps regulate the genes of embryonic stem cells
7. Embryonic Stem Cells Treated With Growth Factor Reverse Hemophilia In Mice: UNC Researchers
8. Vitamin As paradoxical role in influencing symmetry during embryonic development revealed
9. Human embryonic stem cells have the potential to develop into eggs and sperm in the laboratory
10. Canadas first embryonic stem cell lines
11. Researchers make embryonic-like stem cells from umbilical cord blood
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... global,specialty biopharmaceutical company announces results for the year to,December 31, 2008 - a year which has seen significant ... ... Q4 2008 (1), Product sales ... 27% $0.70 bn + 7%(3), Product sales, ...
... NEWARK, Del., Feb. 19 Lightwave Logic, Inc. (OTC ... technology company focused on the development of electro-optic polymer ... optical computing, announced today the addition of Anthony J. ... for 30 years in medicinal chemistry and brings a ...
... most widely used drugs, is also one of the trickiest ... risk of serious problems when given the standard starting dose. ... medicine" based on genetic information, an international research team has ... of the blood-thinning drug for each patient. , Three ...
Cached Biology Technology:Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 2Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 3Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 4Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 5Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 6Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 7Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 8Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 9Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 10Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 11Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 12Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 13Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 14Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 15Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 16Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 17Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 18Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 19Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 20Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 21Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 22Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 23Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 24Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 25Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 26Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 27Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 28Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 29Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 30Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 31Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 32Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 33Lightwave Logic, Inc. Announces the Addition of Anthony J. Cocuzza, PhD to its Technology Team 2Genetic information personalizes warfarin prescribing 2Genetic information personalizes warfarin prescribing 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: