Navigation Links
Earlier bites by uninfected mosquitoes boost West Nile deaths in lab mice
Date:11/15/2007

GALVESTON, Texas Theres one more reason to try to avoid being bitten by mosquitoes, scientists have discovered: bites from mosquitoes that arent infected by the West Nile virus may make the disease worse in people who acquire it later from West Nile-infected mosquitoes.

Researchers from the University of Texas Medical Branch at Galveston (UTMB) announced their discovery in a paper published online by the journal PLoS ONE. In the paper, they describe experiments showing that lab mice on which mosquitoes have previously fed are far more likely to die from West Nile infection than are mice unexposed to such mosquito bites.

The effect is induced by mosquito saliva, according to UTMB professor Stephen Higgs, one of the papers senior authors.

This virus is transmitted from mosquitoes in saliva, and wed already demonstrated that mosquito saliva has an effect on the vertebrate immune system that makes West Nile infection worse, Higgs said. What this new work shows is that the saliva delivered by even earlier feedings can also alter the course of the infection. This is important, because in natural situations in many parts of the world Southeast Texas, for example animals and some people are being exposed to mosquito feeding almost continuously.

In their experiments, researchers exposed sedated mice to feeding by between 15 and 20 Aedes aegypti mosquitoes for an hour once a week. Scientists then allowed a single West Nile virus-infected mosquito to feed once on each of these mice and also on each of a control group of mice that were previously unbitten by mosquitoes.

The results were striking: 68 percent of mice exposed to two weekly mosquito feedings died of West Nile virus, and those exposed to four weekly mosquito feedings suffered a 91 percent mortality rate. By contrast, the virus killed only 27 percent of the mice previously unexposed to saliva from mosquitoes that were free of West Nile infection. Analyses of res
'/>"/>

Contact: Jim Kelly
jpkelly@utmb.edu
409-772-8791
University of Texas Medical Branch at Galveston
Source:Eurekalert

Page: 1 2

Related biology news :

1. New molecular clock from LLNL and CDC indicates smallpox evolved earlier than believed
2. Researchers detect hint of oxygen 50 to 100 million years earlier than first believed
3. Green tea boosts production of detox enzymes, rendering cancerous chemicals harmless
4. Rutgers high school outreach gets $3 million boost from NSF
5. Breast cancer research and inkjet tissue printing get NSF boost
6. Breastfeeding boost IQ in infants with helpful genetic variant
7. Small-scale fishing in Mexico rivals industrial fisheries in accidental turtle deaths
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: