Navigation Links
Carin Göring's remains identified by researchers at Uppsala University
Date:12/21/2012

The putative remains of Carin Gring, wife of Nazi leader Herman Gring, were found in 1991 at a site close to where she had been buried. In a recently published article, Maria Allen, professor of forensic genetics at Uppsala University, Sweden, and her associates present evidence supporting that it is Carin Gring's remains that have been identified.

The Swedish Carin Gring was married to the well-known Nazi leader Herman Gring. When she died in 1931 she was buried in Stockholm, but three years later Herman Gring had her remains moved to his residence Karinhall outside Berlin. At the end of the war, Karinhall was destroyed, and thereafter it was unclear what had happened to her remains. In 1951 skeletal parts were found that were thought to come from Carin Gring, and they were cremated and buried in Sweden. Forty years later, in 1991, treasure hunters found a casket with remains that could also be Carin Gring's. They were sent to Sweden and the National Board of Forensic Medicine for identification.

Marie Allen and her colleagues, together with Anna Kjellstrm at the Stockholm University osteoarchaeological research laboratory, have now examined the remains to determine if they can come from Carin Gring. Analyses of the total of 26 bones showed that they are from an adult woman. DNA analyses confirmed that they are from a woman.

The researchers then performed two kinds of genetic analyses. A comparison of so-called mitochondrial DNA evinced identical DNA sequences between the skeleton and Carin Gring's son, indicating a mother-child relationship.

"The variant of mitochondrial DNA we saw in the bones is a relatively common one, occurring in about 10 per cent of all Europeans. Therefore we went on to study nuclear DNA," says Marie Allen.

Analyses of DNA from cell nuclei is difficult if the DNA is degraded, which is often the case in skeletons that have been buried. Nevertheless, the scientists managed to analyse several p
'/>"/>

Contact: Marie Allen
Marie.Allen@igp.uu.se
46-070-892-4444
Uppsala University
Source:Eurekalert

Page: 1 2

Related biology news :

1. Computer simulations help explain why HIV cure remains elusive
2. Assessing a new technique for ensuring fresh produce remains Salmonella-free
3. Planarian genes that control stem cell biology identified
4. Hiding in plain sight, a new frog species with a weird croak is identified in New York City
5. Common North American frog identified as carrier of deadly amphibian disease
6. Culprit behind unchecked angiogenesis identified
7. Gene mutation identified as contributor to autism spectrum disorders
8. Researchers identified a protein useful in predicting the risk of pulmonary metastases in breast cancer patients
9. Researchers have identified a gene with a key role in neuronal survival
10. Like curry? New biological role identified for compound used in ancient medicine
11. Jack Spratt diabetes gene identified
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance ... technology to industry leaders such as Intel, Jabra, Atlas, ... biometric wearable products. These products will be showcased at ... Las Vegas . "Our partners ... and robust – with the clinical data to back ...
(Date:12/11/2014)... --Research and Markets , ... ) has announced the addition of the ... their offering. One major trend ... multimodal biometric systems. Multimodal biometric systems utilize more ... and identification purposes. This helps to reduce the ...
(Date:12/10/2014)... , Dec. 9, 2014  Wake Forest Baptist Medical ... building for its School of Medicine. Funding for this ... capital campaign that will be publicly launched next summer. ... located in the former 60 series R.J. Reynolds Tobacco ... Quarter. Construction will begin immediately with plans to be ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4
... conducted by researchers at The University of Texas School ... abuse and dependence among Hispanic male populations in the ... along the U.S.-Mexico border. The expansion is supported ... on Alcohol Abuse and Alcoholism of the National Institutes ...
... book Artificial Gravity , edited by Gilles Clment and ... from the International Academy of Astronautics. This award is given ... the Academy in the fields related to life science. The ... on 28 September 2008 in Glasgow, Scotland. Artificial ...
... 2008) Just three years after it was discovered, a ... the Wildlife Conservation Society, which recently published the first-ever census ... the large, forest-dwelling primate hovers at 1,117 individuals, according to ... Oryx . The population estimate was the ...
Cached Biology News:Survey of Hispanics and alcohol dependence 2
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... , , , , , , ... , 1Thermo Finnigan, Piscataway, NJ; , ... , Chemical Structure Validation , ... of ion trap mass spectrometers , , ...
... , , , , , , David Barnidge ... , Neuromics, Inc., Minneapolis, MN , ... , ICAT Analysis , , , ... ProteomeX integrated proteomics workstation., , , , , , ...
... , , , , , ... Center for Neurologic Diseases, Brigham and Womens Hospital, Harvard , ... , , , Genetic manipulations using neuronal cells ... RNA (siRNA) , to primary neuronal cultures is of critical ...
Cached Biology Technology:Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 2Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 3Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 4Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 5Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 6Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 7Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 8Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 9Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 2Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 3Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 4Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 5Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 6Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 7Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 2Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 3Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 4Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 5
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: