Navigation Links
Bioinspired and Nanoengineered Surfaces: Technologies, Applications and Global Markets
Date:6/27/2013

p>SUMMARY 122

INDUSTRY STRUCTURE 122

COMPANY PROFILES 122

NUMBER OF COMPANIES AND GEOGRAPHIC DISTRIBUTION 122

FIGURE 11 GEOGRAPHICAL DISTRIBUTION OF COMPANIES WITH ACTIVE

NANOENGINEERED SURFACES COMMERCIAL INTERESTS (%) 122

U.S. COMPANIES 123

TABLE 44 U.S. COMPANIES COMMERCIALLY DEVELOPING NES APPLICATIONS 124

FOREIGN COMPANIES 126

TABLE 45 FOREIGN ORGANIZATIONS DEVELOPING NES APPLICATIONS 126

DETAILED COMPANY PROFILES 127

Aculon, Inc. 127

Agency for Science, Technology and Research (A*STAR) 128

BASF AG 129

BigSky Technologies LLC 129

Biotomo Pty. Ltd. 130

Clear-Tone Hearing Aid Labs Inc. 130

C-Voltaics 130

Delmic BV 131

Devan Chemicals NV 131

Diamon-Fusion International, Inc. 132

DryWired 132

Entegris, Inc. 133

Furukawa Kikou Corp. Ltd. 133

General Electric Global Research 134

HzO, Inc. 135

Italcementi S.P.A 136

Lightmotif B.V. 136

Liquipel, LLC 137

L'Oreal International 137

Lotus Leaf Coatings 138

Magnolia Solar, Inc. 139

mPhase Technologies, Inc. 139

Nanofilm, Ltd. 140

Nanomech Inc. 141

Nanopool GmbH 141

nanoShell Ltd. 142

Nanosys Inc. 142

Nanotec-USA 143

Nano-Tex, Inc. 144

NanoTouch Materials, LLC 144

Nanoveu Pte. Ltd. 145

nGimat Co. 146

P2i Ltd. 147

PolymerPlus, LLC 148

PureTi, Inc. 149

Rolith Inc. 150

Schott AG 151

Toto USA, Inc. 152

tripleO Performance Solution 153

ZBD Displays Ltd. 153

 

CHAPTER 15 APPENDIX: ABBREVIATIONS, ACRONYMS AND UNITS 156

 

ABBREVIATIONS AND ACRONYMS 156

UNITS 157

 

 

 

LIST OF TABLES

 

SUMMARY TABLE GLOBAL
'/>"/>

SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Related biology news :

1. Bioinspired fibers change color when stretched
2. ASU awarded $3 million to research solar energy technologies, launch energy Ph.D. program
3. NAPCO Security Technologies, Inc. to Demonstrate New Product Capabilities at 2013 ISC West Conference and Exhibition
4. DNA Sequencing: Emerging Technologies and Applications
5. Over 30 years of global soil moisture observations for climate applications
6. Synthetic diamond steps closer to next generation of high performance electrochemical applications
7. Service Credit Union Selects DigitalPersona to Secure Access to Network and Applications
8. BGI debuts new tool PDXomics for tumor xenograft research and applications
9. Wrinkled surfaces could have widespread applications
10. Breakthrough study opens door to broader biomedical applications for Raman spectroscopy
11. DigitalPersona Announces U.are.U Software Development Kit (SDK) for Android Applications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: