Navigation Links
Bioinspired and Nanoengineered Surfaces: Technologies, Applications and Global Markets
Date:6/27/2013

AYS 76

TEN-YEAR GLOBAL MARKET PROJECTION 77

TABLE 25 GLOBAL MARKET PROJECTIONS FOR ELECTRONIC NES APPLICATIONS,

THROUGH 2022 ($ MILLIONS) 77

 

CHAPTER 9 NANOENGINEERED SURFACES MARKET APPLICATIONS: ENERGY AND

 

ENVIRONMENTAL 79

SUMMARY 79

COMMERCIAL INITIATIVES 79

NEAR-TERM 79

TABLE 26 MAIN COMMERCIAL ENERGY AND ENVIRONMENTAL END-USE

APPLICATIONS FOR NANOENGINEERED SURFACES TECHNOLOGIES 79

Battery 80

Fuel Cells 81

Heat Exchangers 81

Oil and Gas Flow Equipment 81

Oil/Water Separation 81

Solar Panels 82

C-Voltaics 82

Magnolia Solar, Inc. 82

Rolith, Inc. 83

Wind and Steam Turbines 83

POTENTIAL LONGER-TERM COMMERCIAL INITIATIVES 84

Energy 84

TABLE 27 POTENTIAL LONGER-TERM COMMERCIAL ENERGY MARKET END USES

FOR NANOENGINEERED SURFACES 84

Oil-Water Separation and Remediation 85

TABLE 28 POTENTIAL LONGER-TERM COMMERCIAL ENVIRONMENTAL MARKET END

USES FOR NANOENGINEERED SURFACES 85

MARKETS, ENTRY AND GROWTH 85

BATTERY 85

FUEL CELLS 86

HEAT EXCHANGERS 86

OIL AND GAS FLOW EQUIPMENT 86

SOLAR PANELS 87

Rigid (Silicon) 87

Flexible (Organic Photovoltaics) 87

TEN-YEAR GLOBAL MARKET PROJECTION 88

TABLE 29 GLOBAL MARKET PROJECTIONS FOR ENERGY AND ENVIRONMENTAL NES

APPLICATIONS, THROUGH 2022 ($ MILLIONS) 88

 

CHAPTER 10 NANOENGINEERED SURFACES MARKET APPLICATIONS: MATERIALS 90

 

SUMMARY 90

COMMERCIAL INITIATIVES 90

NEAR-TERM 90

TABLE 30 MAIN COMMERCIAL MATERIALS MARKET END-USE APPLICATIONS FOR

NANOENGINEERED SURFACES TECHNOLOGIES 90

Cement for Architectural Concrete 91

Self-Cleaning Building Materials 91

Concrete 91

Commercial and Residential Aluminum 92

Commercial and Resi
'/>"/>

SOURCE Reportlinker
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18

Related biology news :

1. Bioinspired fibers change color when stretched
2. ASU awarded $3 million to research solar energy technologies, launch energy Ph.D. program
3. NAPCO Security Technologies, Inc. to Demonstrate New Product Capabilities at 2013 ISC West Conference and Exhibition
4. DNA Sequencing: Emerging Technologies and Applications
5. Over 30 years of global soil moisture observations for climate applications
6. Synthetic diamond steps closer to next generation of high performance electrochemical applications
7. Service Credit Union Selects DigitalPersona to Secure Access to Network and Applications
8. BGI debuts new tool PDXomics for tumor xenograft research and applications
9. Wrinkled surfaces could have widespread applications
10. Breakthrough study opens door to broader biomedical applications for Raman spectroscopy
11. DigitalPersona Announces U.are.U Software Development Kit (SDK) for Android Applications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: