Navigation Links
BYU study: Using a gun in bear encounters doesn't make you safer
Date:3/6/2012

Carrying a gun in bear country doesn't mean you're more protected in the event of a bear encounter, according to new research out of Brigham Young University.

A study led by BYU biologist and bear expert Tom S. Smith found that firing a gun is no more effective in keeping people from injury or death during bear attacks than not using a firearm.

"It really isn't about the kind of gun you carry, it's about how you carry yourself," said Smith, who has researched bears in the field for 20 years. "We need to respect an animal that could potentially take our lives."

Smith and his colleagues analyzed 269 incidents of bear-human conflicts in Alaska for the study, appearing in the forthcoming issue of the Journal of Wildlife Management. Those incidents involved 444 people and 357 bears, 300 of which were brown bears.

The researchers found no statistical difference in the outcome (no injury, injury or fatality) when they compared those who used their gun in an aggressive encounter (229 instances) to those who had firearms but did not use them (40 instances).

The implication is that firearms should not be a substitute for doing the right things to avoid unwanted encounters in bear habitat. Although a shooter may be able to kill an aggressive bear, injuries to the shooter and others also can occur.

This finding is especially relevant given the 2010 law allowing guns in national parks.

"We're seeing more and more people in bear country with guns," Smith said. "Yet guns, for most people, are not their best option. You don't even need a gun if you behave appropriately."

Behaving appropriately, according to the authors, means following the conventional wisdom for avoiding bear encounters:

  • hike in groups
  • avoid areas of poor visibility
  • make noise as appropriate
  • avoid startling mothers with cubs
  • be more cautious in brown bear country

"This study provid
'/>"/>

Contact: Todd Hollingshead
toddh@byu.edu
801-422-8373
Brigham Young University
Source:Eurekalert

Page: 1 2

Related biology news :

1. Study: Nations urban forests losing ground
2. UF study: Rules may govern genome evolution in young plant species
3. Study: Quebec ban on fast-food ads reduced consumption of junk food
4. Study: Communicating health risk is a risky task for FDA
5. Study: Crop diversity myths persist in media
6. Study: Residential washers may not kill hospital-acquired bacteria
7. UF-led study: Invasive amphibians, reptiles in Florida outnumber world
8. Study: New process that can save at-risk cancer patients is effective and significantly less costly
9. Study: Severe low temperatures devastate coral reefs in Florida Keys
10. Study: Climate change to increase Yellowstone wildfires dramatically
11. Study: People at risk for panic buffered from stressor by high levels of physical activity
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... 19, 2014  Roche (SIX: RO, ROG; OTCQX: RHHBY) ... (Bina), a privately held company based in ... provides a big data platform for centralized management ... Bina,s proprietary on-market Genomic Management Solution, Bina-GMS 1 ... perform fast and scalable analyses to maximize the ...
(Date:12/19/2014)... Today, TiFiber, Inc. announced ... and future company headquarters in Fort Smith, Arkansas ... that safely and effectively control dangerous microorganisms. Fort ... historic, strong support for manufacturing, but also due ... technology-based companies such as TiFiber. , In ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)...   ISN has released its third annual ... publication series. With data aggregated from over eight ... within its online contractor management platform, ISNetworld, this three-part ... (KPI) statistics. The Contractor ... is available in two industry specific volumes: Oil ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 2Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 4ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: