Navigation Links
Ancient shrimp-like animals had 'modern' hearts and blood vessels
Date:4/7/2014

An international team of researchers from the University of Arizona, China and the United Kingdom has discovered the earliest known cardiovascular system, and the first to clearly show a sophisticated system complete with heart and blood vessels, in fossilized remains of an extinct marine creature that lived over half a billion years ago. The finding sheds new light on the evolution of body organization in the animal kingdom and shows that even the earliest creatures had internal organizational systems that strongly resemble those found in their modern descendants.

"This is the first preserved vascular system that we know of," said Nicholas Strausfeld, a Regents' Professor of Neuroscience at the University of Arizona's Department of Neuroscience, who helped analyze the find.

Being one of the world's foremost experts in arthropod morphology and neuroanatomy, Strausfeld is no stranger to finding meaningful and unexpected answers to long-standing mysteries in the remains of creatures that went extinct so long ago scientists still argue over where to place them in the evolutionary tree.

The 3-inch-long fossil was entombed in fine dustlike particles now preserved as fine-grain mudstone - during the Cambrian Period 520 million years ago in what today is the Yunnan province in China. Found by co-author Peiyun Cong near Kunming, it belongs to the species Fuxianhuia protensa, an extinct lineage of arthropods combining advanced internal anatomy with a primitive body plan.

"Fuxianhuia is relatively abundant, but only extremely few specimens provide evidence of even a small part of an organ system, not even to speak of an entire organ system," said Strausfeld, who directs the UA Center for Insect Science. "The animal looks simple, but its internal organization is quite elaborate. For example, the brain received many arteries, a pattern that appears very much like a modern crustacean."

In fact, Strausfeld p
'/>"/>

Contact: Daniel Stolte
stolte@email.arizona.edu
520-626-4402
University of Arizona
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Melting glaciers, enough sand to bury London, and ancient ecosystem engineering
2. Ancient civilizations reveal ways to manage fisheries for sustainability
3. Ancient whale species sheds new light on its modern relatives
4. Ancient Egyptian cotton unveils secrets of domesticated crop evolution
5. Ammonites found mini oases at ancient methane seeps
6. New coelacanth find rewrites history of the ancient fish
7. LSU research finds orangutans host ancient jumping genes
8. Whale population size, dynamics determined based on ancient DNA
9. Ancient giant turtle fossil revealed
10. Like curry? New biological role identified for compound used in ancient medicine
11. Tongue analysis software uses ancient Chinese medicine to warn of disease
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Ancient shrimp-like animals had 'modern' hearts and blood vessels
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... global,specialty biopharmaceutical company announces results for the year to,December 31, 2008 - a year which has seen significant ... ... Q4 2008 (1), Product sales ... 27% $0.70 bn + 7%(3), Product sales, ...
... NEWARK, Del., Feb. 19 Lightwave Logic, Inc. (OTC ... technology company focused on the development of electro-optic polymer ... optical computing, announced today the addition of Anthony J. ... for 30 years in medicinal chemistry and brings a ...
... most widely used drugs, is also one of the trickiest ... risk of serious problems when given the standard starting dose. ... medicine" based on genetic information, an international research team has ... of the blood-thinning drug for each patient. , Three ...
Cached Biology Technology:Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 2Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 3Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 4Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 5Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 6Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 7Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 8Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 9Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 10Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 11Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 12Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 13Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 14Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 15Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 16Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 17Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 18Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 19Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 20Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 21Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 22Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 23Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 24Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 25Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 26Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 27Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 28Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 29Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 30Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 31Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 32Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 33Lightwave Logic, Inc. Announces the Addition of Anthony J. Cocuzza, PhD to its Technology Team 2Genetic information personalizes warfarin prescribing 2Genetic information personalizes warfarin prescribing 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: