Navigation Links
Alnylam and UMass Medical School announce Tuschl I patent upheld in European opposition proceedings
Date:3/1/2012

Cambridge, Mass., and Worcester, Mass., March 1, 2012 Alnylam Pharmaceuticals, Inc. (Nasdaq: ALNY), a leading RNAi therapeutics company, and the University of Massachusetts Medical School (UMMS) reported today that the European Patent Office (EPO) has upheld the Tuschl I '726 patent (EP 1309726) in oral opposition proceedings held in Munich, Germany. The requested claims of the '726 patent were upheld without any modification. Opponents included Sanofi-Aventis Deutschland GmbH, Silence Therapeutics AG, and BASF SE.

Inventors on the patent are David P. Bartel, PhD, a Howard Hughes Medical Institute Investigator and professor of biology at the Massachusetts Institute of Technology; Phillip A. Sharp, PhD, Institute Professor at the Koch Institute for Integrative Cancer Research at the Massachusetts Institute of Technology and a 1993 Nobel Laureate; Thomas Tuschl, PhD, a Howard Hughes Medical Institute Investigator and professor at Rockefeller University; and Phillip D. Zamore, PhD, a Howard Hughes Medical Institute Investigator and the Gretchen Stone Cook Professor of Biomedical Sciences at the University of Massachusetts Medical School, where he co-directs the RNA Therapeutics Institute.

"The Tuschl family of patents defines key discoveries central to the advancement of RNAi therapeutics to patients," said James P. McNamara, PhD, executive director, Office of Technology Management, University of Massachusetts Medical School. "The Tuschl I patent is a critical invention by Professors Tuschl, Zamore, Bartel, and Sharp regarding the RNAi mechanism. We are pleased to see this patent fully upheld in Europe in these opposition proceedings."

"We are very pleased with the outcome of these opposition proceedings which resulted in the claims from the Tuschl I '726 patent being fully upheld. This decision by the EPO affirms our belief in the validity of these claims, and the novelty of the Tuschl I invention, and supports the relevance of Tuschl
'/>"/>

Contact: Mark Shelton
mark.shelton@umassmed.edu
508-856-2000
University of Massachusetts Medical School
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Mass Biologic Labs/UMass Med School and Medarex license C. difficile monoclonal antibody to Merck
2. UMass Medical School study points to genetic link in apnea of prematurity
3. UMASS Medical Schools human stem cell bank makes available first seven stem cell lines
4. UMass Amherst biologists use GPS to map bats teeth to explore evolutionary adaptations to diet
5. UMass med school professor wins coveted emerging-investigator award
6. UMass Amherst entomologists begin to control winter moth infestation in eastern Massachusetts
7. UMass researcher points to suppression of evidence on radiation effects by 1946 Nobel Laureate
8. UMass Amherst wins major grant to host $7.5 million Northeast Climate Science Center
9. UMass Amherst ecologists among the first to record and study deep-sea fish noises
10. Inspired by gecko feet, UMass Amherst scientists invent super-adhesive material
11. UMass Amherst chemical engineers say mini-cellulose molecule unlocks biofuel chemistry
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: