Navigation Links
APS names 2 minority outreach fellows
Date:3/25/2008

(2005).

Education and Role Modeling for Young Minorities in Science

As APS K-12 Minority Outreach Fellows, the women will visit K-12 classrooms to talk about their career paths and to serve as role models for other minority students. In addition the Fellows will:

  • Conduct outreach activities for high school teachers and students at the APS annual meeting, held as part of the Experimental Biology (EB) 2008 (and EB09) conference.

  • Serve as a Physiologist-in-Residence at the APS Science Teaching Forum, a week of hands-on science training for middle school and high school teachers.

  • Visit K-12 minority student classrooms in their home towns during the 2008-2009 school year to deliver career presentations and lead hands-on physiology activities. They will also encourage pre-college minority students who are underrepresented in science African Americans, Native Americans, Hispanics and Pacific Islanders to think about becoming biomedical researchers.

  • Represent the APS at the national Annual Biomedical Research Conference for Minority Students (ABRCMS), a national conference designed to facilitate increased minority involvement in biomedical and behavioral science careers. The Fellows will present APS awards to undergraduate students for best oral and poster presentations in the physiological sciences during the conference.

  • Represent the APS at the Society for Advancement of Chicanos and Native Americans in Science (SACNAS) national conference, designed to engage participants from all scientific fields in discourse on a specific science-focused theme, and

  • Reach out to a local school near their institution to participate in PhUn (Physiology Understanding) Week (program details at http://www.phunweek.org) in the fall.

The fellowship covers conference registration fees a
'/>"/>

Contact: Brooke Bruthers
BBruthers@the-aps.org
301-634-7226
American Physiological Society
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Genetic Alliance names Genetic Testing as its official journal
2. Biophysical Society announces winners of 2008 Minority Travel Awards
3. Rutgers high school outreach gets $3 million boost from NSF
4. 19 researchers selected as 2008 Leopold Leadership Fellows
5. 2008 Pew Fellowship in Marine Conservation awarded to Dr. Marie-Joëlle Rochet from IFREMER
6. 2008 Pew Fellowship in Marine Conservation awarded to Fan Meng; first Chinese fellow
7. 2008 Pew Fellowship in Marine Conservation awarded to Dr. Ussif Rashid Sumaila
8. Dr. Andrew Constable awarded 2008 Pew Fellowship in marine conservation
9. 2008 Pew Fellowship in marine conservation awarded to UM Rosenstiels Dr. Andrew Baker
10. Pew Institute for Ocean Science awards 5 fellowships in support of global marine conservation
11. Damon Runyon Cancer Research Foundation awards prestigious fellowships to 17 top young investigators
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: