Navigation Links
A whale of a discovery: New sensory organ found in rorqual whales
Date:5/23/2012

Scientists at the University of British Columbia and the Smithsonian Institution have discovered a sensory organ in rorqual whales that coordinates its signature lunge-feeding behaviour and may help explain their enormous size.

Rorquals are a subgroup of baleen whales including blue, fin, minke and humpback whales. They are characterized by a special, accordion-like blubber layer that goes from the snout to the navel. The blubber expands up to several times its resting length to allow the whales to engulf large quantities of prey-laden water, which is then expelled through the baleen to filter krill and fish.

The study, to be featured on the cover of the journal Nature, details the discovery of an organ at the tip of the whale's chin, lodged in the ligamentous tissue that connects their two jaws.

NB: Illustrations of lunge-feeding and the location of the sensory organ, photos of the researchers at work at the Icelandic whaling station and a comprehensive Frequently Asked Questions are available at http://nmnh.typepad.com/pyenson_lab/nature-rorquals-organ.html.

Samples were collected from recently deceased fin and minke whale carcasses captured as part of Icelandic commercial whaling operations. Commercial whaling in Iceland resumed in 2006 and quotas are determined annually by its government.

Scanning of the whale's chin revealed a grape fruit-sized sensory organ, located between the tips of the jaws, and supplied by neurovascular tissue.

The research team was assisted by technicians at FPInnovations, the owner of Canada's only X-ray computed tomography (XRCT) machine large enough to accommodate the massive specimens. Used to scan giant logs, the XRCT machine provides a three dimensional map of the internal structure of whale tissues.

"We think this sensory organ sends information to the brain in order to coordinate the complex mechanism of lunge-feeding, which involves rotating the jaws, inver
'/>"/>

Contact: Heather Amos
heather.amos@ubc.ca
604-822-3213
University of British Columbia
Source:Eurekalert

Page: 1 2

Related biology news :

1. Whale population size, dynamics determined based on ancient DNA
2. Study amplifies understanding of hearing in baleen whales
3. New iPad, iPhone app helps mariners avoid endangered right whales
4. How to make high-end perfumes without whale barf
5. Ancient whale species sheds new light on its modern relatives
6. Giant squids giant eyes: The better to see hungry whales with
7. Genetic survey of endangered Antarctic blue whales shows surprising diversity
8. Blue whale behavior affected by man-made noise
9. What do killer whales eat in the Arctic?
10. Can we save the whales by putting a price on them?
11. Details of ancient shark attack preserved in fossil whale bone
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: