Navigation Links
2011 HFSP Nakasone Award for Michael Elowitz of Caltech
Date:3/31/2011

The Human Frontier Science Program Organization (HFSPO) is pleased to announce that the 2011 HFSP Nakasone Award has been conferred upon Michael Elowitz of the California Institute of Technology for his pioneering work on the importance of noise in gene expression as a source of biological variation. The HFSP Nakasone Award was established to honour scientists who have made key breakthroughs in fields at the forefront of the life sciences. It recognizes the vision of former Prime Minister Nakasone of Japan in the creation of the Human Frontier Science Program. The recipient will give the HFSP Nakasone Lecture at the annual meeting of HFSP awardees to be held in Montreal, Canada in June 2011.

Michael Elowitz is Professor of Biology, Bioengineering and Applied Physics, Bren Scholar and Howard Hughes Medical Institute (HHMI) Investigator. His work has been honoured by many awards, including the Presidential early Career Award for Scientists and Engineers, the most prestigious award given by the U.S. government to early career scientists.

Cells must function reliably despite inherent stochasticity, or noise, due to the small copy number of their components. Prior to Dr. Elowitz's work, such cellular noise was treated as a mysterious property, or a nuisance, with no clear way of evaluating its extent and functional impact. Dr. Elowitz's work introduced the conceptual and experimental tools to detect gene expression noise and distinguish it from other sources of variability, to quantify its level, and to evaluate its effect on cellular function. Genetic noise is now considered a core aspect of biology, that functions actively in diverse cellular functions, including differentiation, regulation, and evolution.

The impact of this insight is profound. Noise has gone from being a curiosity of cellular life to a key process whose effects must be considered in almost any analysis of biological systems. Thus, stem cell differentiation and reprogr
'/>"/>

Contact: Martin Reddington
mreddington@hfsp.org
Human Frontier Science Program
Source:Eurekalert

Page: 1 2

Related biology news :

1. The first HFSP Nakasone award goes to Karl Deisseroth of Stanford University
2. Karl Deisseroth of Stanford University receives HFSP Nakasone Award
3. NIH doles out $3M in new innovator awards to 2 UC San Diego faculty
4. Wistar Institute researcher receives New Innovator award from NIH
5. Stevens awarded $1M for advanced biofuels research
6. NIH awards Clemson bioengineer $1.5 million to improve durability of tissue heart valves
7. L-1 Identity Solutions Awarded New Massachusetts RMV Drivers License Contract Valued at an Estimated $32 Million
8. Entomological Society of America names 2008 award winners
9. 8 National Medals of Science awardees to be honored at gala, then the White House
10. BIO-keys(R) Law Enforcement Group Awarded $700,000 in New Contracts
11. Broad Institute awarded major grant to bolster epigenomics research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: